PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.008G138000.1
Common NamePHAVU_008G138000g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family FAR1
Protein Properties Length: 220aa    MW: 24915.5 Da    PI: 8.2684
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.008G138000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR185.48.9e-2748137190
                FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                         kfY +YA++vGF vr+ + ++s  +g++  r++ C+k+g++ ++k +   e+++r++ r gCka++ vk+ek+gkw+vt++ ++HnH+l 
  Phvul.008G138000.1  48 KFYIDYARRVGFVVRIMQRRRSGIDGRTLARRLGCNKQGFSPNNKGALGPEKKPRPSAREGCKATILVKLEKSGKWVVTRFIKDHNHPLI 137
                         6***************************************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031017.5E-2548137IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MDFVVVDSDK ANEAECSCLE ESTSIYEGVE IQEPYVGMEF DSEVAARKFY IDYARRVGFV  60
VRIMQRRRSG IDGRTLARRL GCNKQGFSPN NKGALGPEKK PRPSAREGCK ATILVKLEKS  120
GKWVVTRFIK DHNHPLIATA NGFGTVGDKD KKISELTMEL ERQDQLCAAY REKLLSFINN  180
VEEETEELST KIQLVIENVR RAESEMKKCS QNRKPWCLT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150370.0AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007140743.11e-163hypothetical protein PHAVU_008G138000g
TrEMBLV7B4B61e-163V7B4B6_PHAVU; Uncharacterized protein
STRINGGLYMA18G24443.11e-147(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96531104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12850.12e-75FAR1 family protein